What is the catalog number for RRM2 Peptide - C-terminal region?

The catalog number for RRM2 Peptide - C-terminal region is orb1999291.

What sizes are available for RRM2 Peptide - C-terminal region?

RRM2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RRM2 Peptide - C-terminal region in stock?

RRM2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RRM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

R2, RR2, RR2M

UniProt

P31350

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001025.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-428474-LAC-2 200 µL

Mitochondrial Topo I Lentiviral Activation Particles (m2)

Sign In for Pricing

View Details

E45M12460V-2 50 µL

CNOT4 Mouse Monoclonal Antibody [Clone 2A5]

Sign In for Pricing

View Details

MBS2060911-01 0.1 mL

FITC-Linked Polyclonal Antibody to Sperm Protein 17 (Sp17)

Sign In for Pricing

View Details

MBS2060911-02 0.2 mL

FITC-Linked Polyclonal Antibody to Sperm Protein 17 (Sp17)

Sign In for Pricing

View Details

MBS2060911-03 0.5 mL

FITC-Linked Polyclonal Antibody to Sperm Protein 17 (Sp17)

Sign In for Pricing

View Details

MBS2060911-04 1 mL

FITC-Linked Polyclonal Antibody to Sperm Protein 17 (Sp17)

Sign In for Pricing

View Details