POU2F2 Peptide - N-terminal region
POU2F2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OCT2, OTF2, Oct-2
UniProt
P09086
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001193954.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3827606 1.0 µg DNA
Rhoc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
225047-01 50 µL
PIP5KI gamma (Phosphatidylinositol 4-phosphate 5-Kinase Type-1 gamma, PIP5K1-gamma, PtdIns (4) P-5-Kinase 1 gamma, Phosphatidylinositol 4-phosphate 5-Kinase Type I gamma, PIP5KIgamma, PIP5K1C, KIAA0589, PIP5KI y, PIP5KI-y) discontinued
Sign In for Pricing
View Details 225047-02 100 µL
PIP5KI gamma (Phosphatidylinositol 4-phosphate 5-Kinase Type-1 gamma, PIP5K1-gamma, PtdIns (4) P-5-Kinase 1 gamma, Phosphatidylinositol 4-phosphate 5-Kinase Type I gamma, PIP5KIgamma, PIP5K1C, KIAA0589, PIP5KI y, PIP5KI-y) discontinued
Sign In for Pricing
View Details MBS9352174 Inquire
Goat Squamous Cell Carcinoma Antigen (SCCA) ELISA Kit
Sign In for Pricing
View Details