POU2F2 Peptide - N-terminal region
POU2F2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OCT2, OTF2, Oct-2
UniProt
P09086
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001193954.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2443-86H1-ML750 100 µL
CD98 (4F2 Cell Surface Antigen Heavy Chain, 4F2 Heavy Chain Antigen, 4F2hc, 4T2HC, Antigen Defined by Monoclonal Antibody 4F2 Heavy Chain, CD98 Heavy Chain, CD98HC, Lymphocyte Activation Antigen 4F2 Large Subunit, MDU1, Monoclonal 44D7, NACAE, Solute Carrier Family 3 (Activators of Dibasic and Neutral Amino Acid Transport) Member 2, SLC3A2) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
