Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGT Peptide - C-terminal region

AGT Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANHU, hFLT1, SERPINA8

UniProt

P01019

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000020.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma Adducin (ADD3) (NM_016824) Human Recombinant Protein
TP309129M 100 µg

gamma Adducin (ADD3) (NM_016824) Human Recombinant Protein

Sign In for Pricing
View Details
SCN2B (N-term) Rabbit Polyclonal Antibody
AP08900PU-N 50 µg

SCN2B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAF4 Polyclonal Antibody
E-AB-13444-01 20 µL

NDUFAF4 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAF4 Polyclonal Antibody
E-AB-13444-02 60 µL

NDUFAF4 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAF4 Polyclonal Antibody
E-AB-13444-03 120 µL

NDUFAF4 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAF4 Polyclonal Antibody
E-AB-13444-04 200 µL

NDUFAF4 Polyclonal Antibody

Sign In for Pricing
View Details