Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGT Peptide - C-terminal region

AGT Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANHU, hFLT1, SERPINA8

UniProt

P01019

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000020.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP9-2 activation kit by CRISPRa
GA113307 1 Kit

Human KRTAP9-2 activation kit by CRISPRa

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), CF488A conjugate, 0.1mg/mL
BNC880737-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TXNDC6 (NME9) Human Gene Knockout Kit (CRISPR)
KN414826 1 Kit

TXNDC6 (NME9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM100 (NM_018286) Human Over-expression Lysate
LC402665 20 µg

TMEM100 (NM_018286) Human Over-expression Lysate

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2230-01 50 μL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2230-02 100 µL

COLEC12 Antibody

Sign In for Pricing
View Details