CTTN Peptide - middle region
CTTN Peptide - middle region
Product Specifications
Product Name Alternative
EMS1
UniProt
Q14247
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001171669.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP74949_P050-HRP 100 µL
HNRNPL Antibody - middle region : HRP (ARP74949_P050-HRP)
Sign In for Pricing
View Details 
K1167402 1.0 µg DNA
KRT8P16 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
TL301595V 500 µL Each
SLC35B3 Human shRNA Lentiviral Particle (Locus ID 51000)
Sign In for Pricing
View Details 252459-PE 100 µL
TCEAL1 (Transcription Elongation Factor A (SII) -like 1, SIIR, p21, pp21) (PE)
Sign In for Pricing
View Details