What is the catalog number for CTTN Peptide - middle region?

The catalog number for CTTN Peptide - middle region is orb1999282.

What sizes are available for CTTN Peptide - middle region?

CTTN Peptide - middle region is available in the following size(s): 100 µg.

Is CTTN Peptide - middle region in stock?

CTTN Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CTTN Peptide - middle region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171669.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR15079188 1 Vial

Lentiviral human ZNF862 shRNA (UAS) - Lentiviral human ZNF862 shRNA (UAS, RFP) (100)

Sign In for Pricing

View Details

FAB1754PECY7 0.1 mL

Rat Monoclonal Integrin alpha 5/CD49e Antibody (235112) [PE/Cy7]

Sign In for Pricing

View Details

OR1042381-01 50 mg

7,8-Dihydro-5H-pyrano[4,3-b]pyridin-3-amine

Sign In for Pricing

View Details

OR1042381-02 100 mg

7,8-Dihydro-5H-pyrano[4,3-b]pyridin-3-amine

Sign In for Pricing

View Details

OR1042381-03 250 mg

7,8-Dihydro-5H-pyrano[4,3-b]pyridin-3-amine

Sign In for Pricing

View Details

OR1042381-04 500 mg

7,8-Dihydro-5H-pyrano[4,3-b]pyridin-3-amine

Sign In for Pricing

View Details