What is the catalog number for CTTN Peptide - middle region?

The catalog number for CTTN Peptide - middle region is orb1999281.

What sizes are available for CTTN Peptide - middle region?

CTTN Peptide - middle region is available in the following size(s): 100 µg.

Is CTTN Peptide - middle region in stock?

CTTN Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CTTN Peptide - middle region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171669.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17631156 3x 1.0 µg DNA

DAAM1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing

View Details

MBS668851-01 1 Vial

CTLA4 Stable Cell Line

Sign In for Pricing

View Details

MBS668851-02 5x1 Vial

CTLA4 Stable Cell Line

Sign In for Pricing

View Details

ELI-15610h 96 Tests

Human Solute carrier family 35 member E2, SLC35E2 ELISA KIT

Sign In for Pricing

View Details

NBP2-74263H 0.1 mL

Mouse Monoclonal SNX12 Antibody (OTI3A4) [HRP]

Sign In for Pricing

View Details

LV712854 1.0 µg DNA

NPM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing

View Details