Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Peptide - middle region

CTTN Peptide - middle region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171669.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD4 Polyclonal Antibody
E-AB-12686-01 20 µL

ABCD4 Polyclonal Antibody

Sign In for Pricing
View Details
ABCD4 Polyclonal Antibody
E-AB-12686-02 60 µL

ABCD4 Polyclonal Antibody

Sign In for Pricing
View Details
ABCD4 Polyclonal Antibody
E-AB-12686-03 120 µL

ABCD4 Polyclonal Antibody

Sign In for Pricing
View Details
ABCD4 Polyclonal Antibody
E-AB-12686-04 200 µL

ABCD4 Polyclonal Antibody

Sign In for Pricing
View Details
OPRL1 Protein Vector (Human) (pPM-C-HA)
PV029527 500 ng

OPRL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NUP54 Rabbit Polyclonal Antibody (Fluoro647)
orb3095921 100 µg

NUP54 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details