Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT2 Peptide - C-terminal region

SIRT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SIR2, SIR2L, SIR2L2

UniProt

Q8IXJ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHOSPHO2 shRNA Plasmid (m)
sc-152232-SH 20 µg

PHOSPHO2 shRNA Plasmid (m)

Sign In for Pricing
View Details
ALF14-55-Fuji Label Attachment System Accessories
310843 1 Pack (1 Piece (s) x 1 Pack)

ALF14-55-Fuji Label Attachment System Accessories

Sign In for Pricing
View Details
Mouse Fibronectin ELISA Kit
GWB-E40929 96 Well

Mouse Fibronectin ELISA Kit

Sign In for Pricing
View Details
2-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) sulfanyl]acetic acid
EJB35737-01 100 mg

2-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) sulfanyl]acetic acid

Sign In for Pricing
View Details
2-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) sulfanyl]acetic acid
EJB35737-02 1 g

2-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) sulfanyl]acetic acid

Sign In for Pricing
View Details
ADAM12 (ADAM12, MCMP, MLTN, MLTNA, MCMPMltna, A disintegrin and metalloproteinase domain 12, Meltrin alpha) (APC) discontinued
A0859-25P-APC 100 µL

ADAM12 (ADAM12, MCMP, MLTN, MLTNA, MCMPMltna, A disintegrin and metalloproteinase domain 12, Meltrin alpha) (APC) discontinued

Sign In for Pricing
View Details