SIRT2 Peptide - C-terminal region
SIRT2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SIR2, SIR2L, SIR2L2
UniProt
Q8IXJ6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001180215.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9901284-01 48 Well
Porcine Heat Shock 70kDa Protein 12A (HSPA12A) ELISA Kit
Sign In for Pricing
View Details MBS9901284-02 96 Well
Porcine Heat Shock 70kDa Protein 12A (HSPA12A) ELISA Kit
Sign In for Pricing
View Details MBS9901284-03 5x 96 Well
Porcine Heat Shock 70kDa Protein 12A (HSPA12A) ELISA Kit
Sign In for Pricing
View Details MBS9901284-04 10x 96 Well
Porcine Heat Shock 70kDa Protein 12A (HSPA12A) ELISA Kit
Sign In for Pricing
View Details 
MBS2709739-01 24 Strip Well
Human Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15)(Sandwich ELISA) ELISA Kit
Sign In for Pricing
View Details MBS2709739-02 48 Well
Human Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15)(Sandwich ELISA) ELISA Kit
Sign In for Pricing
View Details