Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-B Peptide - middle region

HLA-B Peptide - middle region

Product Specifications

Product Name Alternative

AS, HLAB, B-4901

UniProt

P30480

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

XP_011545540.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf122 HDR Plasmid (h)
sc-415750-HDR 20 µg

C10orf122 HDR Plasmid (h)

Sign In for Pricing
View Details
OR2AG2 AAV Vector (Human) (CMV)
35041101 1 µg

OR2AG2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
C17orf78 Rabbit Polyclonal Antibody (Biotin)
orb2104687 100 µL

C17orf78 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mv.1.Lu [NBL-7; Mv1Lu] Cell Line
CL-0489 1x 10^6 Cells/Vial - 2 Vials

Mv.1.Lu [NBL-7; Mv1Lu] Cell Line

Sign In for Pricing
View Details
Notrilobolide
MBS5821649 Inquire

Notrilobolide

Sign In for Pricing
View Details
FHL1 Rabbit Polyclonal Antibody
orb627037-01 50 µg

FHL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details