HLA-B Peptide - middle region
HLA-B Peptide - middle region
Product Specifications
Product Name Alternative
AS, HLAB, B-4901
UniProt
P30480
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
XP_011545540.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10455887 96 Well
Guinea Pig 5 Hydroxytryptamine Receptor 2B ELISA
Sign In for Pricing
View Details 
MBS6373416-01 0.1 mL
CDC20 (Cell Division Cycle Protein 20 Homolog, p55CDC) (MaxLight 405)
Sign In for Pricing
View Details MBS6373416-02 5x 0.1 mL
CDC20 (Cell Division Cycle Protein 20 Homolog, p55CDC) (MaxLight 405)
Sign In for Pricing
View Details