Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Peptide - middle region

RUNX1 Peptide - middle region

Product Specifications

Product Name Alternative

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

UniProt

Q01196

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001890.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mixture of p-Digallic Acid and m-Digallic Acid
TRC-D445080-1MG 1 mg

Mixture of p-Digallic Acid and m-Digallic Acid

Sign In for Pricing
View Details
IFluor® 555 Tyramide
45105-AAT 200 Slides

IFluor® 555 Tyramide

Sign In for Pricing
View Details
Recombinant Cytokeratin-5 Antibody
RC-15324-01 50 μL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-5 Antibody
RC-15324-02 100 µL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-5 Antibody
RC-15324-03 1 mL

Recombinant Cytokeratin-5 Antibody

Sign In for Pricing
View Details
HCN3 Rabbit Polyclonal Antibody
TA367591 100 µL

HCN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details