Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Peptide - middle region

RUNX1 Peptide - middle region

Product Specifications

Product Name Alternative

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

UniProt

Q01196

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001890.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opipramol-d4
TRC-O669602-1MG 1 mg

Opipramol-d4

Sign In for Pricing
View Details
Human C16orf73 (MEIOB) activation kit by CRISPRa
GA116789 1 Kit

Human C16orf73 (MEIOB) activation kit by CRISPRa

Sign In for Pricing
View Details
Salbutamol Glyoxal Impurity
TRC-S085540-50MG 50 mg

Salbutamol Glyoxal Impurity

Sign In for Pricing
View Details
Angiopoietin like 4 (ANGPTL4) (NM_001039667) Human Over-expression Lysate
LC422106 20 µg

Angiopoietin like 4 (ANGPTL4) (NM_001039667) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Boc-L-glutamic Acid Alpha-Benzyl Ester
TRC-B656100-5G 5 g

N-Boc-L-glutamic Acid Alpha-Benzyl Ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802642 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details