Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUFU Peptide - middle region

SUFU Peptide - middle region

Product Specifications

Product Name Alternative

SUFUH, SUFUXL, PRO1280

UniProt

Q9UMX1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171604.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2D (NM_172128) Human Tagged ORF Clone Lentiviral Particle
RC222121L1V 200 µL

CAMK2D (NM_172128) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC5A3 Antibody - middle region
OASG06723-100UL 100 µL

SLC5A3 Antibody - middle region

Sign In for Pricing
View Details
Mouse Monoclonal TTC9C Antibody (7H10)
H00283237-M06-100ug 100 µg

Mouse Monoclonal TTC9C Antibody (7H10)

Sign In for Pricing
View Details
Human anti streptolysin O antibody (IgM) ELISA kit
GTR10403140 96 Well

Human anti streptolysin O antibody (IgM) ELISA kit

Sign In for Pricing
View Details
Human Ataxin 10 (ATXN10) ELISA kit
GTR10438937 96 Well

Human Ataxin 10 (ATXN10) ELISA kit

Sign In for Pricing
View Details
CAMSAP1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0358706 1.0 µg DNA

CAMSAP1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details