Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E Peptide - middle region

EIF4E Peptide - middle region

Product Specifications

Product Name Alternative

CBP, EIF4F, AUTS19, EIF4E1, eIF-4E, EIF4EL1

UniProt

P06730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001124150.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit
MBS455635-01 48 Tests

Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit
MBS455635-02 96 Tests

Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit
MBS455635-03 5x 96 Tests

Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit
MBS455635-04 10x 96 Tests

Human Fatty Acid Binding Protein 7, Brain (FABP7) ELISA Kit

Sign In for Pricing
View Details
4- (2-Octylamino) diphenylamine
orb2814184-01 25 mg

4- (2-Octylamino) diphenylamine

Sign In for Pricing
View Details
4- (2-Octylamino) diphenylamine
orb2814184-02 50 mg

4- (2-Octylamino) diphenylamine

Sign In for Pricing
View Details