FKBP5 Peptide - middle region
FKBP5 Peptide - middle region
Product Specifications
Product Name Alternative
P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10
UniProt
Q13451
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001139247.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC050391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details