Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H1 Peptide - middle region

GTF2H1 Peptide - middle region

Product Specifications

Product Name Alternative

P62, BTF2, TFB1, TFIIH

UniProt

P32780

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135779.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI14 Antibody, HRP conjugated
A67865-100UG 100 µg

RAI14 Antibody, HRP conjugated

Sign In for Pricing
View Details
HSP10, 1-102aa, Human, E Coli
MBS203119-01 0.02 mg

HSP10, 1-102aa, Human, E Coli

Sign In for Pricing
View Details
HSP10, 1-102aa, Human, E Coli
MBS203119-02 0.1 mg

HSP10, 1-102aa, Human, E Coli

Sign In for Pricing
View Details
HSP10, 1-102aa, Human, E Coli
MBS203119-03 5x 0.02 mg

HSP10, 1-102aa, Human, E Coli

Sign In for Pricing
View Details
HSP10, 1-102aa, Human, E Coli
MBS203119-04 0.5 mg

HSP10, 1-102aa, Human, E Coli

Sign In for Pricing
View Details
HSP10, 1-102aa, Human, E Coli
MBS203119-05 5x 0.1 mg

HSP10, 1-102aa, Human, E Coli

Sign In for Pricing
View Details