What is the catalog number for GTF2H1 Peptide - middle region?

The catalog number for GTF2H1 Peptide - middle region is orb1999259.

What sizes are available for GTF2H1 Peptide - middle region?

GTF2H1 Peptide - middle region is available in the following size(s): 100 µg.

Is GTF2H1 Peptide - middle region in stock?

GTF2H1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GTF2H1 Peptide - middle region

Product Specifications

Product Name Alternative

P62, BTF2, TFB1, TFIIH

UniProt

P32780

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135779.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA308057 100 µL

PNPT1 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

E45M10120V-2 50 µL

BTN1A1 Mouse Monoclonal Antibody [Clone 1G2]

Sign In for Pricing

View Details

orb3052979 100 µL

EGFP Antibody

Sign In for Pricing

View Details

MBS8106818-01 0.1 mL

Anti-STAT6 Antibody, Mouse Monoclonal

Sign In for Pricing

View Details

MBS8106818-02 5x 0.1 mL

Anti-STAT6 Antibody, Mouse Monoclonal

Sign In for Pricing

View Details

orb1620142 100 µL

MORF4L1 Conjugated Antibody

Sign In for Pricing

View Details