Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK2D Peptide - C-terminal region

CAMK2D Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAMKD

UniProt

Q13557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001212.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED7 siRNA (Human)
MBS8238903-01 15 nmol

TMED7 siRNA (Human)

Sign In for Pricing
View Details
TMED7 siRNA (Human)
MBS8238903-02 30 nmol

TMED7 siRNA (Human)

Sign In for Pricing
View Details
TMED7 siRNA (Human)
MBS8238903-03 5x 30 nmol

TMED7 siRNA (Human)

Sign In for Pricing
View Details
Chicken Fibroblast Growth Factor 8 (FGF8) ELISA Kit
abx519526 96 Tests

Chicken Fibroblast Growth Factor 8 (FGF8) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal EDA/Ectodysplasin Antibody (MM0254-3T2) [PerCP]
NBP2-12270PCP 0.1 mL

Mouse Monoclonal EDA/Ectodysplasin Antibody (MM0254-3T2) [PerCP]

Sign In for Pricing
View Details
Human CD200R1/OX2R Antibody
E55A06000 100 µg

Human CD200R1/OX2R Antibody

Sign In for Pricing
View Details