Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK2D Peptide - C-terminal region

CAMK2D Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAMKD

UniProt

Q13557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001212.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dmrt2 shRNA (UAS) - Lentiviral mouse Dmrt2 shRNA (UAS) plasmid
GTR15291427 1 Vial

Lentiviral mouse Dmrt2 shRNA (UAS) - Lentiviral mouse Dmrt2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Tctex1d1 (NM_001163767) Mouse Untagged Clone
MC210534 10 µg

Tctex1d1 (NM_001163767) Mouse Untagged Clone

Sign In for Pricing
View Details
NCX1 Antibody
OM636535-01 100 µL

NCX1 Antibody

Sign In for Pricing
View Details
NCX1 Antibody
OM636535-02 20 µL

NCX1 Antibody

Sign In for Pricing
View Details
NCX1 Antibody
OM636535-03 50 µL

NCX1 Antibody

Sign In for Pricing
View Details
ALK-1 Rabbit mAb
E2R381919 100 µL

ALK-1 Rabbit mAb

Sign In for Pricing
View Details