Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8A Peptide - middle region

RAB8A Peptide - middle region

Product Specifications

Product Name Alternative

MEL, RAB8

UniProt

P61006

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005361.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Cluster Of Differentiation 34 (CD34)
RPU40821-01 50 µg

Recombinant Mouse Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Recombinant Mouse Cluster Of Differentiation 34 (CD34)
RPU40821-02 100 µg

Recombinant Mouse Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Recombinant Mouse Cluster Of Differentiation 34 (CD34)
RPU40821-03 1 mg

Recombinant Mouse Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
BMX Rabbit Polyclonal Antibody
TA311906 100 µL

BMX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Chloro-6-sulfamoylisatoic Anhydride
TRC-C233805-100MG 100 mg

7-Chloro-6-sulfamoylisatoic Anhydride

Sign In for Pricing
View Details
MUS81 antibody - middle region
MBS3215218-01 0.1 mL

MUS81 antibody - middle region

Sign In for Pricing
View Details