Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8A Peptide - middle region

RAB8A Peptide - middle region

Product Specifications

Product Name Alternative

MEL, RAB8

UniProt

P61006

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005361.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sel1l (NM_001039089) Mouse Tagged Lenti ORF Clone
MR221946L4 10 µg

Sel1l (NM_001039089) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human BUB3 Protein
orb424417-01 5 µg

Human BUB3 Protein

Sign In for Pricing
View Details
Human BUB3 Protein
orb424417-02 20 µg

Human BUB3 Protein

Sign In for Pricing
View Details
Human BUB3 Protein
orb424417-03 1 mg

Human BUB3 Protein

Sign In for Pricing
View Details
Human SLC12A1 Knockout A549 cell line
GTR15406292 1 Vial

Human SLC12A1 Knockout A549 cell line

Sign In for Pricing
View Details
TMEM143 Antibody
MBS7002032-01 0.05 mg

TMEM143 Antibody

Sign In for Pricing
View Details