Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF10 Peptide - middle region

TNFSF10 Peptide - middle region

Product Specifications

Product Name Alternative

TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A

UniProt

P50591

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177871.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Carboxylated Osteocalcin ELISA Kit
MBS047860 Inquire

Pigeon Carboxylated Osteocalcin ELISA Kit

Sign In for Pricing
View Details
IL15 Protein Vector (Human) (pPB-N-His)
PV021242 500 ng

IL15 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
OPTN siRNA (Rat)
CRR3630-01 15 nmol

OPTN siRNA (Rat)

Sign In for Pricing
View Details
OPTN siRNA (Rat)
CRR3630-02 30 nmol

OPTN siRNA (Rat)

Sign In for Pricing
View Details
Sorbitan monostearate
T20767-01 100 mg

Sorbitan monostearate

Sign In for Pricing
View Details
Sorbitan monostearate
T20767-02 50 mg

Sorbitan monostearate

Sign In for Pricing
View Details