TNFSF10 Peptide - middle region
TNFSF10 Peptide - middle region
Product Specifications
Product Name Alternative
TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A
UniProt
P50591
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001177871.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N005475 30 Pack (30 Marker (s) x 1 Roll)
WATERSTOFPEROXIDE35%355X37RL-T1-LL-P18 Pipe Markers for Other Liquids
Sign In for Pricing
View Details 
K1096206 1.0 µg DNA
IQCF6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details MBS1180640-01 0.02 mg (E-Coli)
Recombinant Bacillus cereus Anti-sigma F factor (spoIIAB)
Sign In for Pricing
View Details