Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSD Peptide - middle region

CTSD Peptide - middle region

Product Specifications

Product Name Alternative

CPSD, CLN10, HEL-S-130P

UniProt

P07339

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Ala-amc Hydrochloride
TRC-A612350-100MG 100 mg

H-Ala-amc Hydrochloride

Sign In for Pricing
View Details
p23 (PTGES3) Human Gene Knockout Kit (CRISPR)
KN401254 1 Kit

p23 (PTGES3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADO Human Gene Knockout Kit (CRISPR)
KN205583 1 Kit

ADO Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR56 (ADGRG1) Human Gene Knockout Kit (CRISPR)
KN400315 1 Kit

GPR56 (ADGRG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507968 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Mettl21a Mouse Gene Knockout Kit (CRISPR)
KN310000 1 Kit

Mettl21a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details