Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSD Peptide - middle region

CTSD Peptide - middle region

Product Specifications

Product Name Alternative

CPSD, CLN10, HEL-S-130P

UniProt

P07339

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2B7P Human qPCR Primer Pair (NR_001278)
HP219874 200 Reactions

CYP2B7P Human qPCR Primer Pair (NR_001278)

Sign In for Pricing
View Details
TJP2 (NM_004817) Human Recombinant Protein
TP305295L 1 mg

TJP2 (NM_004817) Human Recombinant Protein

Sign In for Pricing
View Details
Human C2orf88 activation kit by CRISPRa
GA113478 1 Kit

Human C2orf88 activation kit by CRISPRa

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), CF647 conjugate, 0.1mg/mL
BNC471324-100 1x 100 µL

MLH1 (MutL Homolog 1) (MLH1/1324), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMP21 Recombinant Rabbit monoclonal Antibody
HA750718 100 µL

TMP21 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), 1mg/mL
BNUM0687-50 1x 50 µL

Cytokeratin 8 (H1 + TS1), 1mg/mL

Sign In for Pricing
View Details