Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Peptide - C-terminal region

BARD1 Peptide - C-terminal region

Product Specifications

UniProt

Q99728

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000456.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HPV-11 E7 (aa 1-98) Protein
VAng-Wyb3012-500gEcoli 500 µg (E. coli)

Recombinant HPV-11 E7 (aa 1-98) Protein

Sign In for Pricing
View Details
MCM4 Antibody (YA2708, Rabbit)
HY-P82963-01 10 µL

MCM4 Antibody (YA2708, Rabbit)

Sign In for Pricing
View Details
MCM4 Antibody (YA2708, Rabbit)
HY-P82963-02 50 μL

MCM4 Antibody (YA2708, Rabbit)

Sign In for Pricing
View Details
MCM4 Antibody (YA2708, Rabbit)
HY-P82963-03 100 µL

MCM4 Antibody (YA2708, Rabbit)

Sign In for Pricing
View Details
BAG6 discontinued
386335 200 µL

BAG6 discontinued

Sign In for Pricing
View Details
N-Methyl-2- (methylamino) -5-pyrimidinecarboxamide
OR1086296-01 250 mg

N-Methyl-2- (methylamino) -5-pyrimidinecarboxamide

Sign In for Pricing
View Details