BARD1 Peptide - C-terminal region
BARD1 Peptide - C-terminal region
Product Specifications
UniProt
Q99728
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000456.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6175079-01 0.1 mL
SH2D3C (SH2 Domain Containing 3C, CHAT, FLJ39664, NSP3, PRO34088) (FITC)
Sign In for Pricing
View Details MBS6175079-02 5x 0.1 mL
SH2D3C (SH2 Domain Containing 3C, CHAT, FLJ39664, NSP3, PRO34088) (FITC)
Sign In for Pricing
View Details MBS1331527-01 0.02 mg (E-Coli)
Recombinant Oryza sativa subsp. japonica Auxin-responsive protein IAA12 (IAA12)
Sign In for Pricing
View Details MBS1331527-02 0.1 mg (E-Coli)
Recombinant Oryza sativa subsp. japonica Auxin-responsive protein IAA12 (IAA12)
Sign In for Pricing
View Details