Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDB2 Peptide - middle region

DDB2 Peptide - middle region

Product Specifications

Product Name Alternative

XPE, DDBB, UV-DDB2

UniProt

Q92466

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000098.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIK4 siRNA (Mouse)
CRN1117-01 15 nmol

GRIK4 siRNA (Mouse)

Sign In for Pricing
View Details
GRIK4 siRNA (Mouse)
CRN1117-02 30 nmol

GRIK4 siRNA (Mouse)

Sign In for Pricing
View Details
PLV3-U6-HMGCS2-shRNA1-CopGFP-Puro Plasmid
PVT66162 2 µg

PLV3-U6-HMGCS2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
TRV-0003506-01 20 µL

Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
TRV-0003506-02 100 µL

Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
TRV-0003506-03 200 µL

Polyclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details