Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMNN Peptide - middle region

GMNN Peptide - middle region

Product Specifications

Product Name Alternative

Gem

UniProt

O75496

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001238918.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prtg AAV siRNA Pooled Vector
37877164 1.0 µg

Prtg AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD30 (Tumor Necrosis Factor Receptor Superfamily Member 8, CD30L Receptor, Ki-1 Antigen, Lymphocyte Activation Antigen CD30, TNFRSF8, D1S166E) discontinued
C2382-10P 50 µL

CD30 (Tumor Necrosis Factor Receptor Superfamily Member 8, CD30L Receptor, Ki-1 Antigen, Lymphocyte Activation Antigen CD30, TNFRSF8, D1S166E) discontinued

Sign In for Pricing
View Details
DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)
245204-ML650 100 µL

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)

Sign In for Pricing
View Details
HA-Tag Polyclonal Antibody
BT-AP06565-01 20 µL

HA-Tag Polyclonal Antibody

Sign In for Pricing
View Details
HA-Tag Polyclonal Antibody
BT-AP06565-02 50 µL

HA-Tag Polyclonal Antibody

Sign In for Pricing
View Details
HA-Tag Polyclonal Antibody
BT-AP06565-03 100 µL

HA-Tag Polyclonal Antibody

Sign In for Pricing
View Details