What is the catalog number for GMNN Peptide - middle region?

The catalog number for GMNN Peptide - middle region is orb1999247.

What sizes are available for GMNN Peptide - middle region?

GMNN Peptide - middle region is available in the following size(s): 100 µg.

Is GMNN Peptide - middle region in stock?

GMNN Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GMNN Peptide - middle region

Product Specifications

Product Name Alternative

Gem

UniProt

O75496

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001238918.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20148011 1.0 µg DNA

FAM83H ORF Vector (Human) (pORF)

Sign In for Pricing

View Details

HY-W953518 1 Each

CRBN ligand-494

Sign In for Pricing

View Details

SN-010 50 Tests

Minute™ Detergent-Free Plant Protein Extraction Kit (50 Tests)

Sign In for Pricing

View Details

042432-ML550 100 µL

STX16, CT (STX16, Syntaxin-16) (MaxLight 550) discontinued

Sign In for Pricing

View Details

orb2585378 100 µg

APLP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing

View Details

MBS1330656-01 0.02 mg (E-Coli)

Recombinant Mouse WD repeat-containing protein 61 (Wdr61)

Sign In for Pricing

View Details