Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL3 Peptide - C-terminal region

CUL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CUL-3, PHA2E

UniProt

Q13618

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244126.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCVRN Antibody - C-terminal region : HRP (ARP34165_P050-HRP)
ARP34165_P050-HRP 100 µL

RCVRN Antibody - C-terminal region : HRP (ARP34165_P050-HRP)

Sign In for Pricing
View Details
Zfp280d Protein Vector (Rat) (pPM-C-HA)
PV317620 500 ng

Zfp280d Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RANKL/CD254 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-20646R-BF680-01 20 µL

RANKL/CD254 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
RANKL/CD254 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-20646R-BF680-02 100 µL

RANKL/CD254 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
IL-1F6 Polyclonal Conjugated Antibody
MBS9454745-01 0.1 mL (Biotin)

IL-1F6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
IL-1F6 Polyclonal Conjugated Antibody
MBS9454745-02 0.1 mL (AF350)

IL-1F6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details