CUL3 Peptide - C-terminal region
CUL3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CUL-3, PHA2E
UniProt
Q13618
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001244126.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2128223-01 0.1 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details MBS2128223-02 0.2 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details MBS2128223-03 0.5 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details MBS2128223-04 1 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details MBS2128223-05 5 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details MBS2128223-06 5x 5 mL
Biotin Linked Polyclonal Antibody to Laminin (LN)
Sign In for Pricing
View Details