Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICK1 Peptide - middle region

PICK1 Peptide - middle region

Product Specifications

Product Name Alternative

PICK, PRKCABP

UniProt

Q9NRD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001034672.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SBSN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV651074 1.0 µg DNA

SBSN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
GLYAT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0871506 1.0 µg DNA

GLYAT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Clathrin Heavy Chain Antibody (YA6273, Rabbit)
HY-P86581-01 10 µL

Clathrin Heavy Chain Antibody (YA6273, Rabbit)

Sign In for Pricing
View Details
Clathrin Heavy Chain Antibody (YA6273, Rabbit)
HY-P86581-02 50 μL

Clathrin Heavy Chain Antibody (YA6273, Rabbit)

Sign In for Pricing
View Details
Clathrin Heavy Chain Antibody (YA6273, Rabbit)
HY-P86581-03 100 µL

Clathrin Heavy Chain Antibody (YA6273, Rabbit)

Sign In for Pricing
View Details
CPA2 (Carboxypeptidase A2) (FITC)
125268-FITC 100 µL

CPA2 (Carboxypeptidase A2) (FITC)

Sign In for Pricing
View Details