Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICK1 Peptide - middle region

PICK1 Peptide - middle region

Product Specifications

Product Name Alternative

PICK, PRKCABP

UniProt

Q9NRD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001034672.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACO1 Antibody
MBS9430744-01 0.1 mL

TACO1 Antibody

Sign In for Pricing
View Details
TACO1 Antibody
MBS9430744-02 5x 0.1 mL

TACO1 Antibody

Sign In for Pricing
View Details
ETS1 Antibody (Phospho-Ser251)
OASG02600-100UL 100 µL

ETS1 Antibody (Phospho-Ser251)

Sign In for Pricing
View Details
DPPA2 Antibody
E035716 100 µg -100 µL

DPPA2 Antibody

Sign In for Pricing
View Details
PATZ1 Mouse Monoclonal Antibody [Clone ID: OTI8D6]
TA809309S 30 µL

PATZ1 Mouse Monoclonal Antibody [Clone ID: OTI8D6]

Sign In for Pricing
View Details
PRR5L ORF Vector (Human) (pORF)
ORF028377 1.0 µg DNA

PRR5L ORF Vector (Human) (pORF)

Sign In for Pricing
View Details