Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HUS1 Peptide - middle region

HUS1 Peptide - middle region

Product Specifications

Product Name Alternative

HHUS1

UniProt

O60921

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004498.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMP3 (IGF2BP3) Rabbit Polyclonal Antibody
TA377380 100 µL

IMP3 (IGF2BP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227C-01 50 Tests

FITC Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
FITC Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227C-02 100 Tests

FITC Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
FITC Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227C-03 2x 100 Tests

FITC Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Human TSPY4 activation kit by CRISPRa
GA118939 1 Kit

Human TSPY4 activation kit by CRISPRa

Sign In for Pricing
View Details
CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B3]
TA502350BM 100 µL

CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B3]

Sign In for Pricing
View Details