Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HUS1 Peptide - middle region

HUS1 Peptide - middle region

Product Specifications

Product Name Alternative

HHUS1

UniProt

O60921

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004498.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: GE 4.90]
AM06127SU-N 100 µL

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: GE 4.90]

Sign In for Pricing
View Details
rac FTY720-d4 Phosphate
TRC-F805012-1MG 1 mg

rac FTY720-d4 Phosphate

Sign In for Pricing
View Details
GFI1 (NM_001127215) Human Over-expression Lysate
LY426716 100 µg

GFI1 (NM_001127215) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL
BNC680264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(4S)-4-Hydroxy-L-isoleucine
TRC-H943570-1MG 1 mg

(4S)-4-Hydroxy-L-isoleucine

Sign In for Pricing
View Details
ATF6 Recombinant Mouse monoclonal Antibody
HA610193 100 µg

ATF6 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details