Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM16 Peptide - middle region

PRDM16 Peptide - middle region

Product Specifications

Product Name Alternative

MEL1, LVNC8, PFM13, CMD1LL

UniProt

Q9HAZ2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071397.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2,6-dimethylquinoline-3-carboxylate
OR3641 1 Each

Ethyl 2,6-dimethylquinoline-3-carboxylate

Sign In for Pricing
View Details
Rabbit Polyclonal SET1B Antibody [Alexa Fluor 350]
NBP3-06532AF350 0.1 mL

Rabbit Polyclonal SET1B Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Y-Box Binding Protein 1 (YBX1) Magnetic Luminex Assay Kit
LKU602486 96 Tests

Y-Box Binding Protein 1 (YBX1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Mouse Tnfrsf10b (NM_020275) AAV Particle
MR205945A1V 250 µL

Mouse Tnfrsf10b (NM_020275) AAV Particle

Sign In for Pricing
View Details
Human FAM20A (Pseudokinase FAM20A) ELISA Kit
EH20029 96 Tests

Human FAM20A (Pseudokinase FAM20A) ELISA Kit

Sign In for Pricing
View Details
Polystyrene AM RAM
H50056023.100G 100 g

Polystyrene AM RAM

Sign In for Pricing
View Details