Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA2 Peptide - C-terminal region

PNMA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MA2, MM2, RGAG2

UniProt

Q9UL42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asialoglycoprotein Receptor 2 (ASGR2) (NM_080912) Human Over-expression Lysate
LY408999 100 µg

Asialoglycoprotein Receptor 2 (ASGR2) (NM_080912) Human Over-expression Lysate

Sign In for Pricing
View Details
Zbtb9 ORF Vector (Rat) (pORF)
ORF079307 1.0 µg DNA

Zbtb9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
1- (2-bromoethoxy) -4-propoxybenzene
sc-332129 1 g

1- (2-bromoethoxy) -4-propoxybenzene

Sign In for Pricing
View Details
Anti-Human IgE APC MAb (Clone :4H10)
30-2864-0.1 0.1 mg

Anti-Human IgE APC MAb (Clone :4H10)

Sign In for Pricing
View Details
Recombinant Rat FCGRT & B2M Heterodimer Protein
MBS2547253-01 0.1 mg

Recombinant Rat FCGRT & B2M Heterodimer Protein

Sign In for Pricing
View Details
Recombinant Rat FCGRT & B2M Heterodimer Protein
MBS2547253-02 5x 0.1 mg

Recombinant Rat FCGRT & B2M Heterodimer Protein

Sign In for Pricing
View Details