What is the catalog number for PPP4R3B Peptide - C-terminal region?

The catalog number for PPP4R3B Peptide - C-terminal region is orb1999236.

What sizes are available for PPP4R3B Peptide - C-terminal region?

PPP4R3B Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PPP4R3B Peptide - C-terminal region in stock?

PPP4R3B Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PPP4R3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSY2, smk1, FLFL2, SMEK2, PP4R3B

UniProt

Q5MIZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116436.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS152908-01 0.05 mg

CCR3 Peptide

Sign In for Pricing

View Details

MBS152908-02 5x 0.05 mg

CCR3 Peptide

Sign In for Pricing

View Details

E11-201105 100 µg -100 µL

UBE2W Polyclonal Antibody

Sign In for Pricing

View Details

PA90485HU-01 50 µg

Rabbit Anti-Human p47-phox (phospho Ser328) Polyclonal Antibody

Sign In for Pricing

View Details

PA90485HU-02 100 µg

Rabbit Anti-Human p47-phox (phospho Ser328) Polyclonal Antibody

Sign In for Pricing

View Details

PA90485HU-03 500 µg

Rabbit Anti-Human p47-phox (phospho Ser328) Polyclonal Antibody

Sign In for Pricing

View Details