Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Peptide - C-terminal region

PPP4R3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSY2, smk1, FLFL2, SMEK2, PP4R3B

UniProt

Q5MIZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116436.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Orange sodium salt ≥90% (Dye content)
237720-01 25 g

Ethyl Orange sodium salt ≥90% (Dye content)

Sign In for Pricing
View Details
Ethyl Orange sodium salt ≥90% (Dye content)
237720-02 100 g

Ethyl Orange sodium salt ≥90% (Dye content)

Sign In for Pricing
View Details
Ethyl Orange sodium salt ≥90% (Dye content)
237720-03 250 g

Ethyl Orange sodium salt ≥90% (Dye content)

Sign In for Pricing
View Details
4- (4-Bromobenzenesulfonyl) morpholine
sc-261324 1 g

4- (4-Bromobenzenesulfonyl) morpholine

Sign In for Pricing
View Details
PTP IA-2 siRNA (m)
sc-62903 10 µM

PTP IA-2 siRNA (m)

Sign In for Pricing
View Details
Opalin monoclonal rabbit recombinant IgG
457 008 50 µg

Opalin monoclonal rabbit recombinant IgG

Sign In for Pricing
View Details