COX20 Peptide - C-terminal region
COX20 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FAM36A
UniProt
Q5RI15
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001299800.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042354-ML405 100 µL
ST6GALNAC4, CT (ST6GALNAC4, SIAT3C, SIAT7D, Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase, ST6GalNAc IV, Sialyltransferase 3C, Sialyltransferase 7D) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
bs-1615R-APC-Cy7 100 µL
Cathepsin D Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details UDA19717-01 50 mg
4-[2,3,5,6-Tetrafluoro-4- (4-hydroxyphenoxy) phenoxy]phenol
Sign In for Pricing
View Details UDA19717-02 0.5 g
4-[2,3,5,6-Tetrafluoro-4- (4-hydroxyphenoxy) phenoxy]phenol
Sign In for Pricing
View Details