Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL16 Peptide - middle region

METTL16 Peptide - middle region

Product Specifications

Product Name Alternative

METT10D

UniProt

Q86W50

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076991.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGGITEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TP53/Cellular tumor antigen p53 ELISA Kit
E45K00473 96 Tests

Human TP53/Cellular tumor antigen p53 ELISA Kit

Sign In for Pricing
View Details
Human fibroblast growth factor-22, FGF-22 ELISA Kit
YLA3785HU-01 48 Tests

Human fibroblast growth factor-22, FGF-22 ELISA Kit

Sign In for Pricing
View Details
Human fibroblast growth factor-22, FGF-22 ELISA Kit
YLA3785HU-02 96 Tests

Human fibroblast growth factor-22, FGF-22 ELISA Kit

Sign In for Pricing
View Details
Anti-TRPS1 Antibody Picoband®, iFluor647 Conjugate
A02328-2-iFluor647 100 µg

Anti-TRPS1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Prealbumin Antibody (YA1719, Rabbit)
HY-P81974-01 10 µL

Prealbumin Antibody (YA1719, Rabbit)

Sign In for Pricing
View Details
Prealbumin Antibody (YA1719, Rabbit)
HY-P81974-02 50 μL

Prealbumin Antibody (YA1719, Rabbit)

Sign In for Pricing
View Details