Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL16 Peptide - middle region

METTL16 Peptide - middle region

Product Specifications

Product Name Alternative

METT10D

UniProt

Q86W50

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076991.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGGITEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYAB ORF Vector (Human) (pORF)
16874011 1.0 µg DNA

CRYAB ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Dctn5 Mouse qPCR Primer Pair (NM_021608)
MP203982 200 Reactions

Dctn5 Mouse qPCR Primer Pair (NM_021608)

Sign In for Pricing
View Details
RPL8 CRISPRa sgRNA lentivector (set of three targets)(Rat)
41924126 3x 1.0µg DNA

RPL8 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Ttc32 (NM_029321) Mouse Tagged Lenti ORF Clone
MR223469L4 10 µg

Ttc32 (NM_029321) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rno-miR-541-3p miRNA Antagomir
orb1911324-01 10 nmol

Rno-miR-541-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-541-3p miRNA Antagomir
orb1911324-02 20 nmol

Rno-miR-541-3p miRNA Antagomir

Sign In for Pricing
View Details