MOB3B Peptide - middle region

Product Specifications

Product Name Alternative

MOB1D, C9orf35, MOBKL2B

UniProt

Q86TA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079037.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP565766 150 µg

Tissue Protein Lysate, Lymph node

View Details

NBP3-20970CL1 0.1 mL

Mouse Monoclonal Pit1 Antibody (PIT1/7262) [CoraFluor 1]

View Details

MBS7000180-01 0.05 mg

PRDM4 Antibody

View Details

MBS7000180-02 0.1 mg

PRDM4 Antibody

View Details

MBS7000180-03 5x 0.1 mg

PRDM4 Antibody

View Details

E47R14017 100 µL

COX8C Rabbit pAb

View Details