MOB3B Peptide - middle region
MOB3B Peptide - middle region
Product Specifications
Product Name Alternative
MOB1D, C9orf35, MOBKL2B
UniProt
Q86TA1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_079037.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLL
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15382154 1 Vial
Lentiviral human RGS17 sgRNA gene knockout kit - Lentiviral human RGS17 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details FAB8550I 0.1 mL
Mouse Monoclonal SerpinB2 Antibody (930109) [Janelia Fluor 549]
Sign In for Pricing
View Details