Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMT Peptide - N-terminal region

PNMT Peptide - N-terminal region

Product Specifications

Product Name Alternative

PENT, PNMTase

UniProt

P11086

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002677.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV648808 1.0 µg DNA

SLC39A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-Procalcitonin Antibody (Detection)
MBS8327256-01 0.1 mg

Anti-Procalcitonin Antibody (Detection)

Sign In for Pricing
View Details
Anti-Procalcitonin Antibody (Detection)
MBS8327256-02 1 mg

Anti-Procalcitonin Antibody (Detection)

Sign In for Pricing
View Details
Anti-Procalcitonin Antibody (Detection)
MBS8327256-03 5x 1 mg

Anti-Procalcitonin Antibody (Detection)

Sign In for Pricing
View Details
Bcl-10 Antibody
C13030-01 50 μL

Bcl-10 Antibody

Sign In for Pricing
View Details
Bcl-10 Antibody
C13030-02 100 µL

Bcl-10 Antibody

Sign In for Pricing
View Details