SRD5A1 Peptide - middle region
SRD5A1 Peptide - middle region
Product Specifications
Product Name Alternative
S5AR 1
UniProt
P18405
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001038.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-41828M-PE 100 µL
Alpha-synuclein Monoclonal Antibody, PE Conjugated
Sign In for Pricing
View Details 
133637-PE 100 µL
SNRPB (Small Nuclear Ribonucleoprotein-associated Proteins B and B', snRNP-B, Sm Protein B/B', Sm-B/Sm-B', SmB/SmB', SNRPB1, COD) (PE)
Sign In for Pricing
View Details 